PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4DL_ADB23D42F.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 233aa    MW: 25766.2 Da    PI: 7.6626
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4DL_ADB23D42F.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.81.6e-152369248
                           SSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  2 grWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                           + WT+eEd+ll + v++ Gg+ +W++I r ++ gR  k+c++rw ++l
  Traes_4DL_ADB23D42F.1 23 KMWTKEEDDLLREQVRRCGGPhNWDSICRGLP-GRNSKSCRLRWCQHL 69
                           67******************************.***********9986 PP

2Myb_DNA-binding46.58.5e-1578120347
                            SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            ++T eEd l+v++ + +G++ W+tIa+ +  gRt++ +k+rw+++
  Traes_4DL_ADB23D42F.1  78 PFTIEEDMLIVKYQATYGNR-WSTIAEFLS-GRTDNAVKNRWNSV 120
                            89******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.9711773IPR017930Myb domain
SuperFamilySSF466892.61E-2721117IPR009057Homeodomain-like
SMARTSM007172.4E-112171IPR001005SANT/Myb domain
PfamPF002491.8E-132269IPR001005SANT/Myb domain
CDDcd001674.60E-132569No hitNo description
Gene3DG3DSA:1.10.10.601.4E-152574IPR009057Homeodomain-like
SMARTSM007173.7E-1275123IPR001005SANT/Myb domain
PfamPF002491.9E-1278121IPR001005SANT/Myb domain
CDDcd001672.75E-1178121No hitNo description
Gene3DG3DSA:1.10.10.601.7E-1878122IPR009057Homeodomain-like
PROSITE profilePS5129417.27578125IPR017930Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MMPTSGNDAG ACDGDSSPHG VKKMWTKEED DLLREQVRRC GGPHNWDSIC RGLPGRNSKS  60
CRLRWCQHLD PRVEAVKPFT IEEDMLIVKY QATYGNRWST IAEFLSGRTD NAVKNRWNSV  120
LRKRQEHAPS QQGQTRPWAP SAARQAAGPE VTPRCLPLFP GSAEEVPEAD TCAAARKCLD  180
LFPLAPGDIR ANAAAEAPPG DMTCGAGDPL TELRLWPAPR VVFDVMPLQA YRM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-252512430127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519190.0JF951919.1 Triticum aestivum clone TaMYB21 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003561848.11e-70PREDICTED: transcription factor MYB23-like
TrEMBLW5EKP11e-174W5EKP1_WHEAT; Uncharacterized protein
STRINGMLOC_63274.11e-142(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49603465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.14e-35myb domain protein 77
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]